PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000144307
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WOX
Protein Properties Length: 380aa    MW: 43208.5 Da    PI: 7.6803
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000144307genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.44.4e-2289148357
                    --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
       Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                    +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  MDP0000144307  89 SRWNPTPEQLRALEELYRRgTRTPSAEQIQHITAQLrkygKIEGKNVFYWFQNHKARERQ 148
                    7*****************99**************************************97 PP

2Wus_type_Homeobox115.62.5e-3788150365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
      MDP0000144307  88 SSRWNPTPEQLRALEELYRRGTRTPSAEQIQHITAQLRKYGKIEGKNVFYWFQNHKARERQKR 150
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.6E-586153IPR001356Homeobox domain
PfamPF000468.9E-2089148IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.3E-989148IPR009057Homeodomain-like
SuperFamilySSF466892.27E-1289154IPR009057Homeodomain-like
CDDcd000862.60E-690150No hitNo description
PROSITE profilePS5007111.22494149IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MWTMGYNDGG HGDFNMPDSF NGRKLRTLIP RSLPSVNNTS STITTPPCLN RSAIYGSHDF  60
LTQYHQLAAM AEQNKRSEFL NTPQVVVSSR WNPTPEQLRA LEELYRRGTR TPSAEQIQHI  120
TAQLRKYGKI EGKNVFYWFQ NHKARERQKR RRQMESSALS AEHDQQLQIS MTSTDNQKKE  180
ELLGASRTGF EVAETKNWAP STNCSTATXV EESVSIQRTA KAAAAECRTD GWIQFDEEEL  240
EQRRNFVERN ATWQMMQLSC PSHPHPHPPT HLINTPPTCD STTARSRAAA TVRRTDQRLF  300
KSHDLSIXIA PYTSETGFNT EQDHGCEESQ TLQLFPLRSG HVKASANANE LSVNDKDHTE  360
LSASFSAHPY PFFEFLPLKN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.154830.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008374987.10.0PREDICTED: WUSCHEL-related homeobox 1
TrEMBLM5WDG70.0M5WDG7_PRUPE; Uncharacterized protein
STRINGGLYMA05G33850.21e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.19e-61WUSCHEL related homeobox 1